Automate Protein Validation with the Adaptyv Skill

Where this fits

You're an ML engineer fine-tuning a protein language model. Your model outputs a dozen candidate sequences for a novel binder, but you have no way to know if they actually express, fold, or bind—without waiting weeks for a manual lab run. The Adaptyv skill closes that gap: it lets your agent submit sequences to a cloud lab, track experiments, and pull back quantitative results, all programmatically. Instead of breaking your workflow to copy-paste sequences into a web portal, your agent handles the entire validation cycle autonomously.

Why agents benefit

• Submit experiments via API – Send protein sequences directly to Adaptyv's cloud lab with a single function call, no human in the loop.
• Track status and retrieve results – Poll experiment progress and download assay outputs (binding, expression, thermostability) as structured data your agent can parse.
• Run computational pre-screening – Use built-in tools like NetSolP, SoluProt, and SolubleMPNN to filter sequences for solubility before spending lab budget.
• Optimize sequences iteratively – Feed wet-lab results back into ESM or other models to refine designs, creating a closed loop between prediction and reality.
• Manage multi-step workflows – Coordinate multiple experiments, handle retries, and aggregate results across runs without manual oversight.

Practical scenarios

Screening a library of designed variants

Your agent generates 50 point-mutants of a therapeutic enzyme. Instead of picking 5 by intuition, it uses Adaptyv to submit all 50 for expression and activity assays, then ranks them by measured performance—not just predicted scores.

Validating a de novo protein before publication

You've designed a novel scaffold with AlphaFold. The agent submits it for thermostability and binding validation, waits for results, and automatically updates your lab notebook with the experimental data, saving days of manual follow-up.

Iterative optimization with feedback loops

After the first round of binding assays, your agent identifies weak binders. It uses SolubleMPNN to propose solubility-improving mutations, submits those to Adaptyv, and compares the new results against the original—all without you touching a pipette.

Add it to your agent workflow

Install the skill with:

npx skills add foryourhealth111-pixel/Vibe-Skills --skill adaptyv

Then configure your API key and call it from your agent:

from skills import adaptyv

adaptyv.submit_experiment(
    sequences=["MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP"],
    assay="binding_elisa"
)
status = adaptyv.get_status(experiment_id="exp_123")
results = adaptyv.get_results(experiment_id="exp_123")

For a deeper walkthrough, check the skill page on OpenAgentSkill.

Compare before adopting

Before committing, compare Adaptyv against other validation options. Look at quality signals like the skill's GitHub stars (currently 3,130) and whether the underlying API is stable. Check maintenance freshness—is the skill updated for API changes? Consider alternatives like manual lab submission or other cloud lab APIs (e.g., Transcriptic). Finally, assess workflow fit: does your agent already handle async tasks? Adaptyv's 21-day turnaround requires your agent to manage long-running jobs gracefully.

Why it is worth tracking

Adaptyv is one of the few skills that bridges generative protein design with physical validation, and its 3k+ stars signal strong community interest. The platform is still in alpha/beta, so the skill may evolve, but the core value—closing the simulation-to-reality loop—is exactly what advanced protein engineering agents need. Track it if you're building in biotech, drug discovery, or synthetic biology; evaluate it when your agent needs to make decisions based on real experimental evidence.